DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and AT3G51290

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001190052.1 Gene:AT3G51290 / 824292 AraportID:AT3G51290 Length:798 Species:Arabidopsis thaliana


Alignment Length:166 Identity:93/166 - (56%)
Similarity:120/166 - (72%) Gaps:6/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRA 95
            :|:||||||:||||:|:...:|||||||||||||:|||||||...|||::.|||::.||:|||..
plant   635 DYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSK 699

  Fly    96 KWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSAL 160
            ||.||::|:.|.|||:|||||||||||||..  :......|||..||..:.|:|.|..|:|||:.
plant   700 KWIPELKHYAPGVPIVLVGTKLDLRDDKQFF--IDHPGAVPITTAQGEELRKQIGAPTYIECSSK 762

  Fly   161 TQKGLKTVFDEAIRSVLCPVVRGPKRHK----CALL 192
            ||:.:|.|||.|||.||.|..:..|:.|    |::|
plant   763 TQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 86/144 (60%)
AT3G51290NP_001190052.1 DUF630 1..59 CDD:282617
DUF632 203..509 CDD:282616
RAS 608..778 CDD:214541 86/144 (60%)
Rop_like 635..779 CDD:206705 86/145 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.