DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and ARAC9

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_566024.1 Gene:ARAC9 / 819077 AraportID:AT2G44690 Length:209 Species:Arabidopsis thaliana


Alignment Length:201 Identity:113/201 - (56%)
Similarity:141/201 - (70%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            ||||.||||||||||||||||:|.||.:|:||||||::|||:||.|.:|||||||||||||:|:|
plant    19 IKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFNANVLVDGKTVNLGLWDTAGQEDYNRVR 83

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKK 133
            ||||...|||::.|||::..||||:..||.||:||:.|:|||:|||||.||||:.|         
plant    84 PLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVLVGTKSDLRDNMQ--------- 139

  Fly   134 LTPITYP--------QGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHK-- 188
             .|..||        ||..:.|||.|:.|:|||:..|..:|.||||||:.||.|..:..||.:  
plant   140 -FPKNYPGACTIFPEQGQELRKEIGALAYIECSSKAQMNVKAVFDEAIKVVLHPPSKTKKRKRKI 203

  Fly   189 --CALL 192
              |.:|
plant   204 GLCHVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 106/179 (59%)
ARAC9NP_566024.1 Rop_like 18..190 CDD:206705 106/180 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.