DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhof

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_001073389.2 Gene:Rhof / 690130 RGDID:1584038 Length:211 Species:Rattus norvegicus


Alignment Length:192 Identity:94/192 - (48%)
Similarity:128/192 - (66%) Gaps:3/192 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :|.|:||||..|||.||:.|...:||..|.|:||:.|:|:|.|..|.:.|.|:||||||||||||
  Rat    20 LKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQEDYDRLR 84

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKK 133
            ||||..|.:.|||:.::||.|::||..||||||.|.|..:|::|:|.|.|||.||:.:.||:..:
  Rat    85 PLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQ 149

  Fly   134 LTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIR---SVLCPVVRGPKRHKCALL 192
            |.||||.|||:..:::....||||||..::.::.||.||.:   |.|....|..|:..|.||
  Rat   150 LEPITYTQGLSACEQMRGALYLECSAKFRENVEDVFREATKVALSALKKAQRQKKQRICLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 87/174 (50%)
RhofXP_001073389.2 Rho4_like 17..211 CDD:206704 92/190 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.