DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhou

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038954118.1 Gene:Rhou / 678766 RGDID:1596918 Length:261 Species:Rattus norvegicus


Alignment Length:172 Identity:101/172 - (58%)
Similarity:129/172 - (75%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDR 66
            :.:|||:|||||||||.|::|||||.:|.|||||.|||:||.|.||.:|:.|.|.|||||:::|:
  Rat    51 RGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDK 115

  Fly    67 LRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKD 131
            ||||.|..||:||:|||:|:|.||:||..||.||:|.|||..|||||||:.|||:|.:.:.:|..
  Rat   116 LRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVKVLIELDK 180

  Fly   132 KKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAI 173
            .|..|:........|:|:.||.|:||||||||.||.|||.||
  Rat   181 CKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 101/171 (59%)
RhouXP_038954118.1 Wrch_1 53..225 CDD:133330 101/170 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.