DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhob

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_071987.1 Gene:Rhob / 64373 RGDID:621309 Length:196 Species:Rattus norvegicus


Alignment Length:179 Identity:103/179 - (57%)
Similarity:126/179 - (70%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAI--KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQED 63
            |.||  |.|||||||.|||||||.::.:.||..|:||||:||.|::.||.|.:.|.|||||||||
  Rat     1 MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQED 65

  Fly    64 YDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEK 128
            ||||||||||.|||.|:|||:.:|.|.||:..||.|||:|.||:||||||..|.|||.|:....:
  Rat    66 YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTE 130

  Fly   129 LKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVL 177
            |...|..|:....|.|||..|.|..||||||.|::|::.||:.|.|:.|
  Rat   131 LARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAAL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 101/174 (58%)
RhobNP_071987.1 RhoA_like 5..179 CDD:206662 99/173 (57%)
Effector region. /evidence=ECO:0000255 34..42 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.