DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhof

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:196 Identity:94/196 - (47%)
Similarity:120/196 - (61%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67
            |:|.|:||||..|||.||:.|....||.:|.|:|||.|...|....|.|.|.|:|||||||||||
Zfish    16 ALKIVIVGDGGCGKTSLLMVYAKGDFPEKYAPSVFDKYVTTVSYGGKDIQLNLYDTAGQEDYDRL 80

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDK 132
            |||||...::.|||:.:.||.||:||:.||:|||||.|...||||:..|.|||.||:.:.:||..
Zfish    81 RPLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCRDAPIILISCKTDLRKDKEKMRRLKAL 145

  Fly   133 KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHK------CAL 191
            ...||||..|....||:.|..||||||..::.::.:|.||.:..|  ..|...||:      |.:
Zfish   146 DQAPITYLLGEQTQKEMNAEIYLECSAKYRENVEDIFREATKRAL--AARAKARHRSKKKKHCTV 208

  Fly   192 L 192
            |
Zfish   209 L 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 88/172 (51%)
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 92/193 (48%)
RHO 19..186 CDD:197554 85/166 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.