DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhoh

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001314902.1 Gene:rhoh / 553413 ZFINID:ZDB-GENE-060228-7 Length:195 Species:Danio rerio


Alignment Length:184 Identity:80/184 - (43%)
Similarity:121/184 - (65%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67
            ::|||:|||.|||||.||:.:|:..||..|.|||::|...:|.:|...|:||||||||.:.:.::
Zfish     8 SVKCVLVGDCAVGKTALLVRFTSETFPDSYRPTVYENTGVDVFMDGIQISLGLWDTAGHDTFRQI 72

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDK 132
            ||:||..|||.|:|:|:.||:|..|:|.||..|||.:.|.||:::|.|:.|.|:       :...
Zfish    73 RPMSYQDTDVVLLCYSVANPSSLNNLRHKWIAEVREYLPKVPVLVVATQTDHRE-------MGPY 130

  Fly   133 KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKR 186
            :....|.|:|..:|:||.|..|||||||:.:|::.||:.|:|:.:....|..:|
Zfish   131 RANCTTSPEGKQVAQEIRAKGYLECSALSNRGVQQVFECAVRTAVNRARRQTRR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 78/172 (45%)
rhohNP_001314902.1 Rho 9..173 CDD:206641 77/170 (45%)
RHO 11..176 CDD:197554 77/171 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.