DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhoub

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001017784.2 Gene:rhoub / 550481 ZFINID:ZDB-GENE-050417-308 Length:237 Species:Danio rerio


Alignment Length:170 Identity:92/170 - (54%)
Similarity:125/170 - (73%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :|||.:||||||||.|::|||||.:|.:|:||.||::||.|.||.:|:.|.|.|||||:::|:||
Zfish    29 LKCVFLGDGAVGKTSLIVSYTTNGYPTKYVPTAFDDFSAVVQVDGQPVRLQLCDTAGQDEFDKLR 93

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKK 133
            ...|.:|||.|:|||:|:||||:|:..||.||:|..||..|:|||||:.|||.|.:.:..|..::
Zfish    94 HFCYTRTDVLLLCFSVVSPASFQNIGEKWVPEIRRRCPLTPVILVGTQCDLRQDVKVLIDLARRR 158

  Fly   134 LTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAI 173
            ..|:......|:|.:|.||.|:|||:||||.||.|||.||
Zfish   159 ERPVLEEDARALADKIGAVSYIECSSLTQKNLKEVFDAAI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 92/170 (54%)
rhoubNP_001017784.2 Wrch_1 29..198 CDD:133330 90/168 (54%)
RHO 31..202 CDD:197554 91/168 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.