DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhof

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001016369.1 Gene:rhof / 549123 XenbaseID:XB-GENE-920536 Length:218 Species:Xenopus tropicalis


Alignment Length:193 Identity:92/193 - (47%)
Similarity:123/193 - (63%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :|.|:||||..|||.||:.|...:||.:|.|:||:.|:..:.:..|.|.|.|:||||||||||||
 Frog    26 VKIVIVGDGGCGKTSLLMVYAKGSFPEQYAPSVFEKYTTTITIGNKDIFLHLYDTAGQEDYDRLR 90

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKK 133
            ||||...::.|||:.:.||.||:||..||:|||.|.|..|||:|:|.|.|||.||:.:.||:..:
 Frog    91 PLSYQDVNLVLICYDVTNPTSFDNVLIKWYPEVHHFCRGVPIVLIGCKTDLRKDKERLRKLRTAQ 155

  Fly   134 LTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGP----KRHKCALL 192
            ..|:||.||....|.|.|.:||||||..::.:..||.||....|..:.|..    |:..|:||
 Frog   156 QEPVTYFQGEDTCKSIQAAEYLECSAKYRENIDNVFKEATLIALNAMKREQKLKRKQKNCSLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 86/171 (50%)
rhofNP_001016369.1 Rho4_like 23..218 CDD:206704 90/191 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.