DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rnd1

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001008073.1 Gene:rnd1 / 493435 XenbaseID:XB-GENE-490045 Length:232 Species:Xenopus tropicalis


Alignment Length:185 Identity:75/185 - (40%)
Similarity:111/185 - (60%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRP 69
            |.|:|||...|||.:|.....:.:|..|:||||:||:|::..:.:.:.|.||||:|...||.:||
 Frog    15 KLVLVGDVHCGKTAMLQVLAKDCYPETYVPTVFENYTASLETEEQRVELSLWDTSGSPYYDNVRP 79

  Fly    70 LSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKL 134
            |.|..:|..|:||.:..|.|.::...||..|:..:||:..|:|:|.|.|||.|..||.:|.::|.
 Frog    80 LCYSDSDAVLLCFDVSRPESLDSAMKKWKSEITDYCPNTRILLIGCKTDLRTDLSTIMELSNQKQ 144

  Fly   135 TPITYPQGLAMAKEIAAVKYLECSALT-QKGLKTVFDEAIRSVLCPVVRGPKRHK 188
            .|::|.||.|:||::.|..||||||.| :|.:.::|..|  |..|.....|...|
 Frog   145 APVSYEQGCAVAKQLGAENYLECSAFTSEKSVHSIFRAA--SSACVNKASPASRK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 71/171 (42%)
rnd1NP_001008073.1 P-loop_NTPase 1..232 CDD:393306 75/185 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.