DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Cdc42

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster


Alignment Length:192 Identity:131/192 - (68%)
Similarity:152/192 - (79%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            ||.|||||||||||||||||||||||.||.||:|||||||:..||:..:|..|||:|||||||||
  Fly     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            ||||||||||||||:|||:|:|:|||||:.||.||:.|||...|.:||||::||||:..|:|||.
  Fly    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLA 130

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL 192
            ..|..|||..||..:|||:.||||:|||||||||||.||||||.:.|.| ....|:.||..|
  Fly   131 KNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEP-PEPTKKRKCKFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 123/172 (72%)
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 123/173 (71%)
RHO 6..179 CDD:197554 122/172 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466330
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
109.900

Return to query results.
Submit another query.