DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rac1a

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_956065.1 Gene:rac1a / 327204 ZFINID:ZDB-GENE-030131-5415 Length:192 Species:Danio rerio


Alignment Length:192 Identity:172/192 - (89%)
Similarity:181/192 - (94%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||.||:||||||||||||||
Zfish     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            ||||||||||||||||||||:|||||||||||:||||||||:.|||||||||||||||.||||||
Zfish    66 RLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLK 130

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL 192
            :||||||||||||||||||.||||||||||||:|||||||||||:||||.....:|.:|.||
Zfish   131 EKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKRRRRRCLLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 162/172 (94%)
rac1aNP_956065.1 Rac1_like 3..176 CDD:206663 162/172 (94%)
RHO 6..179 CDD:197554 161/172 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 344 1.000 Domainoid score I1028
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69035
Inparanoid 1 1.050 364 1.000 Inparanoid score I2132
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm6376
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.