DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhogc

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_955986.1 Gene:rhogc / 324681 ZFINID:ZDB-GENE-030131-3402 Length:191 Species:Danio rerio


Alignment Length:194 Identity:130/194 - (67%)
Similarity:156/194 - (80%) Gaps:5/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            ||.||||||||||||||||||||||||||.|||||||||||....||.:.::|.||||||||:||
Zfish     1 MQTIKCVVVGDGAVGKTCLLISYTTNAFPDEYIPTVFDNYSTQTCVDGRAVSLNLWDTAGQEEYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            |||.||||||.||:||||:.:|:|..|||.||.|||.||||.||::|||||.|||.||:|:||||
Zfish    66 RLRTLSYPQTHVFIICFSVASPSSHANVRHKWHPEVCHHCPGVPVLLVGTKRDLRGDKETLEKLK 130

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRH--KCALL 192
            ::.::|.|..||.|:|:.|.||:|||||||.|:|::.||:||:|:||.|   ..|:|  ||.||
Zfish   131 EQGMSPTTPQQGSALARSIGAVRYLECSALLQEGVREVFNEAVRAVLYP---NAKKHTKKCVLL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 119/172 (69%)
rhogcNP_955986.1 RhoG 1..191 CDD:133277 128/192 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.