DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhobtb2

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001013151.1 Gene:Rhobtb2 / 306004 RGDID:1309924 Length:728 Species:Rattus norvegicus


Alignment Length:213 Identity:80/213 - (37%)
Similarity:120/213 - (56%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...||...:|      :|||:  |.|        .:..:||..
  Rat    12 VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDV 76

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVG 114
            .::|.||||.|  |:.:.|..:|.::||.::|||:.||.|..:|:..|:||::|.||..|:||||
  Rat    77 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVG 139

  Fly   115 TKLDLR-DDKQTIEK--------LKDKKLTPITYPQ-GLAMAKEIAAVKYLECSALTQKGLKTVF 169
            .:|||| .|.:.:.:        :|..::.|   |: |..:|||: .:.|.|.|.:.|.|:|.||
  Rat   140 CQLDLRYADLEAVNRARRPLARPIKPNEILP---PEKGREVAKEL-GIPYYETSVVAQFGIKDVF 200

  Fly   170 DEAIRSVLCPVVRGPKRH 187
            |.|||:.|.     .:||
  Rat   201 DNAIRAALI-----SRRH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 77/198 (39%)
Rhobtb2NP_001013151.1 RhoBTB 13..207 CDD:133275 77/199 (39%)
BTB_POZ 250..475 CDD:365784
BTB2_POZ_RHOBTB2 480..603 CDD:349668
BACK_RHOBTB2 608..704 CDD:350606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.