DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhoh

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001013448.1 Gene:Rhoh / 305341 RGDID:1307623 Length:191 Species:Rattus norvegicus


Alignment Length:186 Identity:77/186 - (41%)
Similarity:120/186 - (64%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            :.:||||:|||.|||||.||:.:|:..||..|.|||::|...:|.:|...|:||||||||.:.:.
  Rat     2 LSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFR 66

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            .:|||||.|.||.|:|:|:.|.:||.|::.||..|||.:.|..|:::|.|:.|.|:       :.
  Rat    67 SIRPLSYQQADVVLMCYSVANHSSFLNLKNKWISEVRSNLPCTPVLVVATQTDQRE-------MG 124

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKR 186
            ..:.:.|...:|..:|:::.|..|||||||:.:|::.||:.|:|:.:....|..:|
  Rat   125 PHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 75/172 (44%)
RhohNP_001013448.1 Rho 5..169 CDD:206641 74/170 (44%)
RHO 7..173 CDD:197554 73/172 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.