DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhov

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_011237767.1 Gene:Rhov / 228543 MGIID:2444227 Length:281 Species:Mus musculus


Alignment Length:189 Identity:101/189 - (53%)
Similarity:128/189 - (67%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            ||||:||||||||:.|::|||.|.:|..|.||..|.:|..|:||..|:.:.|||||||||:||||
Mouse    77 IKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLR 141

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKL-KDK 132
            .|.||.|||||.|||:|.|:||:|:..||.||:|.|.|..|::||||:.|||||...:.:| :..
Mouse   142 SLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGG 206

  Fly   133 KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCAL 191
            :..|:..||...:|::|.|..||||||||||.||.|||.||.|.:        .||..|
Mouse   207 REGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAI--------EHKARL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 97/172 (56%)
RhovXP_011237767.1 Wrch_1 77..250 CDD:133330 97/172 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.