DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhov

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038960142.1 Gene:Rhov / 171581 RGDID:628824 Length:281 Species:Rattus norvegicus


Alignment Length:189 Identity:101/189 - (53%)
Similarity:128/189 - (67%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            ||||:||||||||:.|::|||.|.:|..|.||..|.:|..|:||..|:.:.|||||||||:||||
  Rat    77 IKCVLVGDGAVGKSSLIVSYTCNGYPSRYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLR 141

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKL-KDK 132
            .|.||.|||||.|||:|.|:||:|:..||.||:|.|.|..|::||||:.|||||...:.:| :..
  Rat   142 SLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGG 206

  Fly   133 KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCAL 191
            :..|:..||...:|::|.|..||||||||||.||.|||.||.|.:        .||..|
  Rat   207 REGPVPEPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAI--------EHKARL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 97/172 (56%)
RhovXP_038960142.1 Wrch_1 77..250 CDD:133330 97/172 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.