DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhobtb1

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_003199615.1 Gene:rhobtb1 / 100537290 ZFINID:ZDB-GENE-130530-871 Length:687 Species:Danio rerio


Alignment Length:214 Identity:76/214 - (35%)
Similarity:115/214 - (53%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...|....:|      :|||:  |.|        .:..:||..
Zfish     8 VETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDV 72

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVG 114
            .::|.||||.|  |:.:.|..:|.::||.::|||:.||.|..:|:..|:.|::|.||..|:||||
Zfish    73 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYLEIKHFCPRTPVILVG 135

  Fly   115 TKLDLR-DDKQTIEKLKDKKLTPITYP----------QGLAMAKEIAAVKYLECSALTQKGLKTV 168
            .:|||| .|.:.:.:.:    .|::.|          .|..:|||: .:.|.|.|...|.|:|.:
Zfish   136 CQLDLRYADLEAVNRAR----RPLSRPIKPGDILPPESGREVAKEL-GIPYYETSVFDQFGIKDI 195

  Fly   169 FDEAIRSVLCPVVRGPKRH 187
            ||.|||:.|.     .:||
Zfish   196 FDNAIRAALI-----SRRH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 73/199 (37%)
rhobtb1XP_003199615.1 RhoBTB 9..203 CDD:133275 73/200 (37%)
BTB 355..446 CDD:333434
BTB 477..569 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.