DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhoq

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_031757763.1 Gene:rhoq / 100497782 XenbaseID:XB-GENE-492072 Length:205 Species:Xenopus tropicalis


Alignment Length:195 Identity:121/195 - (62%)
Similarity:150/195 - (76%) Gaps:6/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :||||||||||||||||:||..:|||.||:|||||:|:.:|.|..:...|||:||||||||||||
 Frog    10 LKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGRQYLLGLYDTAGQEDYDRLR 74

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKK 133
            |||||.|||||||||:||||||:||:.:|.||::.:.|:||.:||||::|||||.:|:.||.|.|
 Frog    75 PLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLVGTQIDLRDDPKTLAKLNDVK 139

  Fly   134 LTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRH------KCALL 192
            ..|||..||..:||||.|..|:||||||||||||||||:|.::|.|.....|:.      .|.|:
 Frog   140 EKPITVEQGHKLAKEIGACCYVECSALTQKGLKTVFDESIIAILTPKKTAMKKRLGSRCINCCLI 204

  Fly   193  192
             Frog   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 116/171 (68%)
rhoqXP_031757763.1 Tc10 10..183 CDD:206707 116/172 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.