DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and rhoh

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001120435.1 Gene:rhoh / 100145522 XenbaseID:XB-GENE-950965 Length:190 Species:Xenopus tropicalis


Alignment Length:188 Identity:82/188 - (43%)
Similarity:120/188 - (63%) Gaps:7/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            |.:||||:|||.|||||.||:.:|:.|||..|.|||::|...:|.:|...|:||||||||.:.:.
 Frog     1 MNSIKCVLVGDAAVGKTALLVRFTSEAFPDSYRPTVYENTGVDVYMDGVQISLGLWDTAGNDAFR 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            .:||||....|:.|:|||:.|..||.|||.||..|||.|.|.:|:::|.|:.|.|:       |.
 Frog    66 SIRPLSLQNADIVLLCFSVANHTSFLNVRNKWIGEVRQHLPRIPVLVVATQTDQRE-------LD 123

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHK 188
            ..:|..|....|..:|:::.|..|||||||:.:|::.||:.|:|:.:....:..:||:
 Frog   124 HMRLPCINSIDGKQLAQDVRAKGYLECSALSNRGVQQVFECAVRTAINQAKKRARRHR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 79/172 (46%)
rhohNP_001120435.1 Rho 4..168 CDD:206641 78/170 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.