DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and AT5G42320

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:309 Identity:74/309 - (23%)
Similarity:127/309 - (41%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VSFKAFHRHAEINAYLDELAAAYPSRVSVQV--AGKSYENRDIKTITITNGDGKTGKN----VVF 176
            :::..:|...::...:..|...:|.::|:::  :|....|.::..:|...| ||...:    .:.
plant    40 INWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRG-GKESDDRSNFRIL 103

  Fly   177 LDAGIHAREWIAHAGALYVIHQL-VENFAANSE--LLKD-FDWVIL---PVVNPDGYEYSHTTTR 234
            |..|.|.||.|....|..::..| .|.|..|..  :||: .|.:::   |:.||:|         
plant   104 LTFGQHGRELITSELAFRILSILSEEQFLPNKNGGILKNTLDKLVIKMVPIENPNG--------- 159

  Fly   235 MWRKTRKPISSA--C-----YGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDIL 292
                 ||.:.|.  |     .|.|.|||:...||: ....|..|:...|...|||||||::|.:.
plant   160 -----RKRVESGDLCERRNGRGVDLNRNWGVDWGK-KEKDYDPSEENPGTAPFSEPETQIMRKLA 218

  Fly   293 LSLTGRGKFYLTLHSYGNYLLYPWGWTSALPSSWRDNDEVAQGGADAIKSAT----------GTK 347
            :|....  .::.:||....|..|:           |:..:...|..:.|..|          ..:
plant   219 ISFDPH--IWINVHSGMEALFMPY-----------DHKNITPEGLPSQKMRTLLEKLNKFHCHDR 270

  Fly   348 YTVGS-STNVLYAAAGGSDDYAFGVANFPVSITMELPAGGTGFNPSTSQ 395
            ..:|| ..:|.|.|.|.:.||.:.|...|::.|.|:    .|.|.:.|:
plant   271 CMIGSGGGSVGYLAHGTATDYIYDVVKAPMAFTFEI----YGDNQTASR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416
M14_CP_A-B_like 123..414 CDD:199844 74/304 (24%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 64/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.