DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001364026.1 Gene:Agtpbp1 / 67269 MGIID:2159437 Length:1218 Species:Mus musculus


Alignment Length:310 Identity:54/310 - (17%)
Similarity:101/310 - (32%) Gaps:115/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VALAVENYDGYKIYDINARNAFEKQLLLRLSG---NEAYDF--------------------FDLP 55
            :.:....||.....|||: |.:.:.....:||   ..||.|                    :.:.
Mouse   717 IQIRKSEYDLILNSDINS-NHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQ 780

  Fly    56 RSLDAS-----------------SRVMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDEN 103
            .:|:|.                 ||..|....|:|..:    |.:.::|   ||     ..:|: 
Mouse   781 EALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSY----YTITFTV---NF-----PHKDD- 832

  Fly   104 QNQRLMNLRSAERSVSFKAFH---RHAEINAYLDELAAAY-PSRVSVQVAGKSYENRDI------ 158
                          |.:.|:|   .::.:..:|.:|.:|: |.::        |..:|:      
Mouse   833 --------------VCYFAYHYPYTYSTLQMHLQKLESAHNPQQI--------YFRKDVLCETLS 875

  Fly   159 ----KTITITNGDGKT---------GKNVVFLDAGIHARE----WIAHAGALYVIHQLVENFAAN 206
                ..:|||......         .:..:||.|.:|..|    |:...    .:..|:.|....
Mouse   876 GNICPLVTITAMPESNYYEHICQFRTRPYIFLSARVHPGETNASWVMKG----TLEYLMSNSPTA 936

  Fly   207 SELLKDFDWVILPVVNPDG-YEYSHTTT-------RMWRKTRKPISSACY 248
            ..|.:.:.:.|:|::|||| ...:|..:       |.|:.....:....|
Mouse   937 QSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPNPELHPTIY 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 19/108 (18%)
M14_CP_A-B_like 123..414 CDD:199844 29/161 (18%)
Agtpbp1NP_001364026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..617
Pepdidase_M14_N 704..838 CDD:407865 24/148 (16%)
M14_Nna1 861..1131 CDD:349477 24/138 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1193..1218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.