DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and cpb2

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001025617.1 Gene:cpb2 / 595005 XenbaseID:XB-GENE-969491 Length:421 Species:Xenopus tropicalis


Alignment Length:376 Identity:122/376 - (32%)
Similarity:196/376 - (52%) Gaps:34/376 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDENQ--------------NQRLMNLRSA 114
            |:.||:..   ||:::...|:: .:||:|.::::.|.:|:.              .|:..|..|.
 Frog    51 VLWKPDSN---EHIMKNKEVHF-YVNESFIDTVKAELNESSILYMVLVNNAQELIEQQTFNDTSN 111

  Fly   115 ERSVS--FKAFHRHAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFL 177
            :||.:  ::.:|...:|..::..:...:...:.....|.|:|||.:..:.: :|..||.|:.|::
 Frog   112 QRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSFENRPLYVLKV-SGKEKTAKHAVWI 175

  Fly   178 DAGIHAREWIAHAGALYVIHQLVENFAAN---SELLKDFDWVILPVVNPDGYEYSHTT-TRMWRK 238
            |.||||||||:.|..|:.:...||.:..:   ::||:..|:.||||:|.|||::|.|. .|||||
 Frog   176 DCGIHAREWISPAFCLWFVGHAVEYYGVDLSMTKLLRYLDFYILPVMNADGYQFSWTAKNRMWRK 240

  Fly   239 TR-KPISSACYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFY 302
            .| |...|.|.|||.|||||..|...||||..|.:.:.|..|.||||...:...|.......|.|
 Frog   241 NRSKYTKSNCIGTDLNRNFDAGWCGPGASSDPCHEIYCGPYAESEPEVSAVVSFLKKHQNVVKGY 305

  Fly   303 LTLHSYGNYLLYPWGWTSALPSSWRDNDE---VAQGGADAIKSATGTKYTVGSSTNVLYAAAGGS 364
            :|:|||...:|:|:.:|:   ...:|:||   :::..|:.|:|.:..||..|:....:|.|.|||
 Frog   306 ITVHSYSQMVLFPYSYTN---KKSKDHDELLLLSKKVAEGIRSTSRNKYMYGAGAETIYLAPGGS 367

  Fly   365 DDYAFGVANFPVSITMEL-PAGGTGFNPSTSQIEGFVSETWVGIKAMAQKV 414
            ||:|:.: ....|.|.|| ..|..||......|:...||....:|.:|..:
 Frog   368 DDWAYDL-GIKYSFTFELRDKGMYGFLLPPQLIKPTCSEGITAVKIIAAHI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 9/33 (27%)
M14_CP_A-B_like 123..414 CDD:199844 106/299 (35%)
cpb2NP_001025617.1 Propep_M14 33..104 CDD:366995 11/56 (20%)
M14_CPB2 118..418 CDD:349465 106/305 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.