DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Agbl5

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_038968402.1 Gene:Agbl5 / 362710 RGDID:1598311 Length:901 Species:Rattus norvegicus


Alignment Length:412 Identity:80/412 - (19%)
Similarity:123/412 - (29%) Gaps:162/412 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NQRLMNLRSAERSVSFKAFHRHAEINAY-LDELAAAYPSRVSVQVAGKSYENRDIKTITITNG-- 166
            :||.....||..| ...:.:.|.|:..| ||.|      ||            |:.|||..:|  
  Rat   172 DQRFPENYSAHSS-PLDSIYYHRELLCYSLDGL------RV------------DLLTITSCHGLR 217

  Fly   167 DGK-------------------TGKNVVFLDAGIHAREWIAHAGALYVIHQLVENFAANSE---- 208
            |.:                   |||.:.||.:.:|..|    ..:.:|.:..::......:    
  Rat   218 DDREPRLEQLFPDVGTPRPFRFTGKRIFFLSSRVHPGE----TPSSFVFNGFLDFILRPDDPRAQ 278

  Fly   209 -LLKDFDWVILPVVNPDGYEYSHTTT--------RMWRKTRKPISSACYGTDA------------ 252
             |.:.|.:.::|::||||....|..|        |.:.|....:..|.||..|            
  Rat   279 TLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLN 343

  Fly   253 ---------------------------NRNFDFHWGEV--GASSYSCSDTFKGET------AFSE 282
                                       |.:.:.|.|:.  |.:....::|...|.      ...:
  Rat   344 SKNPSNQQPSSLHLPPEVPLSDLEKANNLHNELHLGQSPDGENHDRWTETEPTEEKTDPVWIMPQ 408

  Fly   283 PETQL---IRDILLSLTGRGKFYLTLHS---------YGN----------YLLYP---------- 315
            |..:|   ..|.:........:|:.||.         |||          .:|||          
  Rat   409 PIPELEEPAPDAIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHF 473

  Fly   316 ------WGWTSALPSSWRDNDEVAQGGADAIKSATG--------TKYTVGSSTNVLYAAAGGSDD 366
                  :...:......||.......|..||..|:|        ..|..|.|.|.:.||...:  
  Rat   474 DFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDN-- 536

  Fly   367 YAFGVAN------FPVSITMEL 382
               |.|:      ||...|:||
  Rat   537 ---GRASPPPPPTFPSRYTVEL 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416
M14_CP_A-B_like 123..414 CDD:199844 75/394 (19%)
Agbl5XP_038968402.1 Pepdidase_M14_N 10..155 CDD:407865
M14_AGBL5_like 183..575 CDD:349455 76/401 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.