DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Cpa6

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011236694.1 Gene:Cpa6 / 329093 MGIID:3045348 Length:459 Species:Mus musculus


Alignment Length:284 Identity:89/284 - (31%)
Similarity:143/284 - (50%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LEKYGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRHAEINAYLDELAAAYPS 142
            |::..:.|.|:.|:..:::   .:||..|...|.||.. ..:::.:|...:|.::|..|....|.
Mouse    98 LQETHIYYKVLIEDLQKAV---ENE
NSLQTQRNRRSLS-EYNYEVYHSLEDIQSWLHHLNQTQPG 158

  Fly   143 RVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALYVIHQLVENF---A 204
            .|.|...|:|||.|.:..:.: ....:..|..|::|.||||||||..|...:.:.:.:..:   .
Mouse   159 LVRVFSIGRSYEGRPLFIMQL-GRKSRAYKRAVWIDCGIHAREWIGPAFCQWFVREAILTYKTDP 222

  Fly   205 ANSELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPISS-ACYGTDANRNFDFHWGEVGASSY 268
            |..::|....:.|:||.|.|||.:|.|..|.|||||...|. .|.|.|||||:...|.:.|||::
Mouse   223 AMKKMLNHLYFYIMPVFNVDGYHFSWTHDRFWRKTRSRDSKFRCRGVDANRNWKVKWCDEGASAH 287

  Fly   269 SCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSALPSSWRDNDEVA 333
            .|.||:.|....||||.:.:.:.|.....|.:.||:.|:|...||||:.:..|...::...:..|
Mouse   288 PCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKYATIPNFSCVEFAA 352

  Fly   334 QGGADAIKSATGTKYTVGSSTNVL 357
            .....|::|..|.:|..|.::..|
Mouse   353 HKAVKALRSVHGIRYRHGPASQTL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 4/19 (21%)
M14_CP_A-B_like 123..414 CDD:199844 79/239 (33%)
Cpa6XP_011236694.1 Propep_M14 48..119 CDD:366995 4/23 (17%)
Peptidase_M14_like 138..382 CDD:386095 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.