DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Cpa6

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:283 Identity:93/283 - (32%)
Similarity:141/283 - (49%) Gaps:11/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALYVIH 197
            :..|....|..|.|...|:|:|.|.:..|.: ....:..|..|::|.||||||||..|...:.:.
  Rat     1 MHHLNQTQPGLVRVFPIGRSFEGRSLLIIQL-GRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVK 64

  Fly   198 QLVENF---AANSELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPISS-ACYGTDANRNFDF 258
            :.:..:   .|..::|....:.|:||:|.|||.:|.|..|.|||||...|. .|.|.|||||:..
  Rat    65 EAILTYKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKV 129

  Fly   259 HWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSALP 323
            .|.:.|||:..|.||:.|....||||.:.:.:.|.....|.:.||:.|:|...||||:.:..|..
  Rat   130 KWCDEGASADPCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKHATI 194

  Fly   324 SSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYAF--GVANFPVSITMEL-PAG 385
            .::...:..|.....|::|..|.:|..|.::..||.::|.|.|:|:  |:   |.|...|| ..|
  Rat   195 PNFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAYKNGI---PYSFAFELRDTG 256

  Fly   386 GTGFNPSTSQIEGFVSETWVGIK 408
            ..||......|:...:||.:.:|
  Rat   257 YFGFLLPEMLIKPTCTETMLAVK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416
M14_CP_A-B_like 123..414 CDD:199844 93/283 (33%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 93/283 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.