DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:302 Identity:51/302 - (16%)
Similarity:102/302 - (33%) Gaps:99/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VALAVENYDGYKIYDINARNAFEKQLLLRLSG---NEAYDF--------------------FDLP 55
            :.:....||.....|||: |.:.:.....:||   ..||.|                    :.:.
  Rat   718 IQIRKSEYDLILNSDINS-NHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQ 781

  Fly    56 RSLDAS-----------------SRVMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDEN 103
            .:|:|.                 ||..|....|:|..:    |.:.::|:..:        :|: 
  Rat   782 EALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSY----YTITFTVVFPH--------KDD- 833

  Fly   104 QNQRLMNLRSAERSVSFKAFH---RHAEINAYLDELAAAY-PSRVSVQ--VAGKSYENRDIKTIT 162
                          |.:.|:|   .::.:..:|.:|.:|: |.::..:  |..::........:|
  Rat   834 --------------VCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVT 884

  Fly   163 ITNGDGKT---------GKNVVFLDAGIHARE----WIAHAGALYVIHQLVENFAANSELLKDFD 214
            ||.....:         .:..:||.|.:|..|    |:...    .:..|:.|......|.:.:.
  Rat   885 ITAMPESSYYEHICQFRTRPYIFLSARVHPGETNASWVMKG----TLEYLMSNSPTAQSLREAYI 945

  Fly   215 WVILPVVNPDG-YEYSHTTT-------RMWRKTRKPISSACY 248
            :.|:|::|||| ...:|..:       |.|:.....:....|
  Rat   946 FKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPNPELHPTIY 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 17/108 (16%)
M14_CP_A-B_like 123..414 CDD:199844 28/153 (18%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865 22/148 (15%)
M14_Nna1 862..1132 CDD:349477 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.