DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and ccpp-1

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:296 Identity:59/296 - (19%)
Similarity:104/296 - (35%) Gaps:92/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EDQEGFEHLLEK---YGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFH---RHA 127
            |:::..|...:|   |.:.::|..:|.|:                       :.:.|:|   .::
 Worm   691 EEKKNVEEQKKKKYYYSIRFNVTFQNTGD-----------------------ICYIAYHYPYTYS 732

  Fly   128 EINAYLDELAAAYPSRVSVQ--VAGKSYENRDIKTITITNGDGK---TGKNVVFLDAGIHAREWI 187
            .:|:.|..|.......|..:  |.|.|.....||.:|||.....   ..:.|:.|.|.:|..|  
 Worm   733 FLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAAREVIVLSARVHPGE-- 795

  Fly   188 AHAGALYVIHQLVENFAANS-----ELLKDFDWVILPVVNPDGY-EYSHTTT-------RMWRKT 239
              ..|.:::..::||.....     .|.:.|.:.|:|::||||. ..||..:       |||.:.
 Worm   796 --TNASWIMQGILENLLCRQSNEMYRLRESFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRP 858

  Fly   240 RKPISSACYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLT 304
            .:.:....:.|.|            ...|.|      |.|..:|..                |:.
 Worm   859 NEALHPEVFATKA------------IIQYLC------EVANKKPFA----------------YVD 889

  Fly   305 LHSYG---NYLLYPWGWTSALPSSWRDNDEVAQGGA 337
            :|.:.   :|.:|    .:....|||.:|.:..|.|
 Worm   890 IHGHSKKWDYFVY----GNNASESWRADDVLDVGAA 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 7/31 (23%)
M14_CP_A-B_like 123..414 CDD:199844 51/239 (21%)
ccpp-1NP_491674.2 M14_Nna1_like_2 738..1011 CDD:199859 49/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.