DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and CPO

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:341 Identity:121/341 - (35%)
Similarity:186/341 - (54%) Gaps:27/341 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FGESLRQERDENQNQRLMNLRSAERSV--------SFKAFHRHAEINAYLDELAAAYPSRVSVQV 148
            :..||.|.|.|          ..::||        |:..:|...||..::.|::..|...|:...
Human    21 YDRSLAQHRQE----------IVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHF 75

  Fly   149 AGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALYVIHQLVENFAANS---ELL 210
            .|.:||...:..:.|:...|.. |.::::|.|||||||||.|...:.:.::::|...||   :||
Human    76 LGVTYETHPMYYLKISQPSGNP-KKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLL 139

  Fly   211 KDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPISS-ACYGTDANRNFDFHWGEVGASSYSCSD-T 273
            ::.|:.:|||:|.|||.|:.||.|:|||:|.|.:: .|:|||.||||:..|..:|||. :|.| |
Human   140 RNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASR-NCQDQT 203

  Fly   274 FKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSALPSSWRDNDEVAQGGAD 338
            |.|....|||||:.:...:.|.......:||:||||..:|.|:|:|....|:..:..:|.|..|:
Human   204 FCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAAN 268

  Fly   339 AIKSATGTKYTVGSSTNVLYAAAGGSDDYAFGVANFPVSITMELPAGGT-GFNPSTSQIEGFVSE 402
            |:|:..||.|.||||.::|||::|.|.|:|..: ..|.|.|.||...|| ||....:||:....|
Human   269 ALKAKYGTNYRVGSSADILYASSGSSRDWARDI-GIPFSYTFELRDSGTYGFVLPEAQIQPTCEE 332

  Fly   403 TWVGIKAMAQKVADKY 418
            |...:.::...|..|:
Human   333 TMEAVLSVLDDVYAKH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 2/5 (40%)
M14_CP_A-B_like 123..414 CDD:199844 111/296 (38%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 111/299 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157685
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.