DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and Cpa3

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:427 Identity:118/427 - (27%)
Similarity:216/427 - (50%) Gaps:36/427 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFAVVLLLASVALAVENYDGYKIYDINARNAFEKQLLLRLSGNEAYDFF------DLPRSLDASS 62
            |.||:  ..::|:|..::|..|::.:..:|.....:|..|:.:...||:      |:..::....
Mouse     6 LMAVI--YTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDF 68

  Fly    63 RVMVKPEDQEGFEHLLEKYGVNYSVINENFGESLRQE---RDENQNQRLMNLRSAERSVSFKAFH 124
            ||..|  :.:..:..||::.::|.::..:..|.:.::   :||...:.           |:..::
Mouse    69 RVSEK--ESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVKDEIAGRH-----------SYAKYN 120

  Fly   125 RHAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAH 189
            ...:|.::.:::...:|..||....|.:.|:..:..:.|...||:  :..:|:|.||||||||:.
Mouse   121 DWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGE--RKAIFMDCGIHAREWISP 183

  Fly   190 AGALYVIHQLVENFAAN---SELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTR-KPISSACYGT 250
            |...:.::|..:::..|   ::||...::.:|||.|.|||.:|.|..|||||.| :..:|.|.||
Mouse   184 AFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGT 248

  Fly   251 DANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYP 315
            |.|||||..|.....::..|.:.::|....||.||:.:.:.:.|.....|.|:|.|||...||.|
Mouse   249 DLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIP 313

  Fly   316 WGWTSALPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDD--YAFGVANFPVSI 378
            :|:|..||.:.:|..:||:...||:.:...|:|..|...:.:|..:|.|.|  |..|:.:   :.
Mouse   314 YGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVYDLGIKH---TF 375

  Fly   379 TMEL-PAGGTGFNPSTSQIEGFVSETWVGIKAMAQKV 414
            ..|| ..|.:||....|:|:....||.:.:|.:|:.:
Mouse   376 AFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 13/74 (18%)
M14_CP_A-B_like 123..414 CDD:199844 95/297 (32%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 13/75 (17%)
Peptidase_M14_like 114..413 CDD:299699 96/315 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.