DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and LOC100490370

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:426 Identity:122/426 - (28%)
Similarity:205/426 - (48%) Gaps:32/426 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLASVALAVENYDGYKIYDINARNAFEKQLLLRLSGNEAYDFFD--LPRSLDASSRVMVK----- 67
            |...|......|||..|.:|...:..:.|.|..:..:...|...  .|..::..:.|.|:     
 Frog    51 LTLQVCCTGTEYDGGNILEITPESEKQVQCLQNILQSWLLDLLKPLQPEDINVKTTVHVRIPSTA 115

  Fly    68 ----PEDQEGFEHLLEKYGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRHAE 128
                .||.......||....|...|.|:       :.|..:.::.:|      ..::..:|...|
 Frog   116 LQLVKEDLLHCSQSLEILTGNVKYIEED-------KIDTKETRKTIN------EYNYTTYHPMNE 167

  Fly   129 INAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGA- 192
            |..:::.:|..:...|:..:.|.:||:|.::.:.|:. ..:..|.:|::|.|||||||||.|.. 
 Frog   168 IYDWINGIAKKHSQFVTQHLLGLTYESRPMQYLKISQ-PSENHKKIVWIDCGIHAREWIAPAFCQ 231

  Fly   193 LYVIHQLVENFAANS---ELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPI-SSACYGTDAN 253
            .:|..|:|:|:..:.   ::|::.|..:|||:|.|||.||.|..|:|||.|... :..|||.|.|
 Frog   232 WFVKEQIVQNYQNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLN 296

  Fly   254 RNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGW 318
            |||:..|....:|:...|::|.|.:..|||||:.:.:.:.|.......:||:|||...:|..:|:
 Frog   297 RNFNVSWCTHRSSTNCSSNSFCGSSPVSEPETRAVVEFVESRKADIVCFLTMHSYSQLILTAYGY 361

  Fly   319 TSALPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYAFGVANFPVSITMELP 383
            ::.|..::.:..:||:..|.|::...||||..|..:.:||.|:|.|.|:...: ....|.|.||.
 Frog   362 STGLSRNYNEIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTSQDWVHDL-GIDFSFTFELR 425

  Fly   384 AGGT-GFNPSTSQIEGFVSETWVGIKAMAQKVADKY 418
            ..|: .|.....||:....||..|:..:.:.|.:||
 Frog   426 DNGSHKFTLPEDQIQPTCEETMAGVMTIIEYVNEKY 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 14/79 (18%)
M14_CP_A-B_like 123..414 CDD:199844 97/296 (33%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700 7/49 (14%)
Peptidase_M14_like 159..457 CDD:416253 97/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.