DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and cpo.1

DIOPT Version :9

Sequence 1:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_031748368.1 Gene:cpo.1 / 100145253 XenbaseID:XB-GENE-989447 Length:451 Species:Xenopus tropicalis


Alignment Length:361 Identity:119/361 - (32%)
Similarity:186/361 - (51%) Gaps:33/361 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FEHLLEKYGVNYSVI---------NENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRHAEI 129
            |:..|.:|.:.:.|:         :.|.|:..||::             ......:..:|...||
 Frog    82 FKENLHQYSIPFEVMIKDVQKLID
SSNVGDYRRQKK-------------ILAEFDYTTYHPMDEI 133

  Fly   130 NAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAGALY 194
            ..::|::..||...||:...|.:||.|.|....|.....|. |.::::|.|||||||||.|...:
 Frog   134 YQWMDQVKEAYSDLVSMHYLGSTYELRPIYYFKIGWPSDKQ-KKIIWMDCGIHAREWIAVAYCQW 197

  Fly   195 VIHQLVENFAAN---SELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTRKPISS-ACYGTDANRN 255
            .:.:::|....|   .::|.:.|:.|:||:|.||:.||....|:|||:|.|.:: :|||.|.|||
 Frog   198 FVKEILETHKTNPLLQKVLHNIDFYIVPVLNIDGFVYSWNVNRLWRKSRSPHNNGSCYGVDLNRN 262

  Fly   256 FDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTS 320
            |:..||.:|||:....:|:.|....||||...:..:|.||......:||:||||..||.|:|:|.
 Frog   263 FNSKWGSIGASNNCRDETYCGTGPASEPEVNAVSKLLGSLKSDVLCFLTIHSYGQLLLLPYGYTK 327

  Fly   321 ALPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYA--FGVANFPVSITMEL- 382
            ....:..:...|||..|..::...||:|.|||::::||:.:|.|.|:|  .|: ||  |.|.|| 
 Frog   328 DPSINHEEMINVAQKAAAKLQEKHGTEYRVGSTSHLLYSNSGSSRDWATDLGI-NF--SYTFELR 389

  Fly   383 PAGGTGFNPSTSQIEGFVSETWVGIKAMAQKVADKY 418
            ..|..||....:||.....||..|:..:.:.|..|:
 Frog   390 DTGAHGFILPANQIRPTCEETMAGVMTIVEHVDAKF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 6/32 (19%)
M14_CP_A-B_like 123..414 CDD:199844 109/297 (37%)
cpo.1XP_031748368.1 Propep_M14 36..105 CDD:396700 4/22 (18%)
M14_CPO 124..421 CDD:349466 109/300 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.