DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT33A and LamC

DIOPT Version :9

Sequence 1:NP_004129.2 Gene:KRT33A / 3883 HGNCID:6450 Length:404 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:416 Identity:114/416 - (27%)
Similarity:184/416 - (44%) Gaps:97/416 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    56 EKETMQFLNDRLASYLEKVRQLERDNAELE---NLIRERSQQQEPLVCASYQSYFKTIEELQQKI 117
            |||.:|.||||||.|::::|.||.:|:.|.   ||.::...::...:.|.|:.......:|..: 
  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDE- 109

Human   118 LCSKSENARLVVQIDNAKLASDDFRTKYETELSLRQLVE----------SDING----------- 161
              :..|.|:|.:.|......:||.:.:.:.:.....:.|          :::||           
  Fly   110 --TAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKK 172

Human   162 --------------LRRILDEL-------TLCRSDLEAQVESLKEELLCLKQNHEQEVNTLR--- 202
                          |||.||:|       ||.|.|||.|.:||:|||....|.|.||:...|   
  Fly   173 FEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRR 237

Human   203 ----CQLGDRLNVEVDAAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQVVSSSE 263
                .::..||:.:.:|    .|.|.|.|.|.|||..:..||.|:|..:..:.:.| |...:.:.
  Fly   238 QIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL-KAAANRAA 297

Human   264 QLQSYQAEIIELRRT-VNALEIELQAQHNLRDS----------LENTLTESEARYSSQLSQVQRL 317
            |..:...|.:.|.|| ::.|..:||   ||.|:          |||.|.....|::       :.
  Fly   298 QGSALATEEVRLMRTKIDGLNAKLQ---NLEDTNAGLNARIRELENLLDTERQRHN-------QY 352

Human   318 ITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKL----PSNPCATTNAC 378
            |.::|::|..:|.::..|.||||.|:|::..|:.||..|..||..|:.:|    |..|  ||::.
  Fly   353 IASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRP--TTDSG 415

Human   379 DKSTGPCIS----------NPCGLRA 394
            ..|.|..::          .|.|.|:
  Fly   416 ISSNGSHLTASASSRSGRVTPSGRRS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT33ANP_004129.2 Head 1..56 114/416 (27%)
Filament 55..366 CDD:278467 104/372 (28%)
Coil 1A 57..91 17/36 (47%)
Linker 1 92..102 0/9 (0%)
Coil 1B 103..203 34/148 (23%)
Linker 12 204..219 3/14 (21%)
Coil 2 220..363 47/153 (31%)
Tail 364..404 10/45 (22%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 104/372 (28%)
ATP-synt_B <67..>142 CDD:304375 15/77 (19%)
MreC <178..>224 CDD:302802 18/45 (40%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.