DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and AT5G42320

DIOPT Version :9

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:295 Identity:68/295 - (23%)
Similarity:123/295 - (41%) Gaps:50/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PYNGRLGTERYYNHEEINQFIEDLAGEHPRRV---FLKTVGRSYEGRWLKTITITNG----DARR 174
            |.|..|    |::.:::.:.|..|...||.::   .:|:..:.|... :..:|...|    |.|.
plant    39 PINWDL----YHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAE-VNVVTYCRGGKESDDRS 98

  Fly   175 NKNVILVDGGFHAREWISPAAATYLIN-----QLVYN-----LEDNADLLLDFDWVILPVVNPDG 229
            |..::|..|. |.||.|:...|..:::     |.:.|     |::..|.|:   ..::|:.||:|
plant    99 NFRILLTFGQ-HGRELITSELAFRILSILSEEQFLPNKNGGILKNTLDKLV---IKMVPIENPNG 159

  Fly   230 YEYTQLSEDTRMWRKTRKPSSSDCIGTDPNRNFDFHWNEEGASDDPCDNIYAGAKPFSEPEALVV 294
            .:..: |.|....|..|        |.|.|||:...|.::....||.:. ..|..||||||..::
plant   160 RKRVE-SGDLCERRNGR--------GVDLNRNWGVDWGKKEKDYDPSEE-NPGTAPFSEPETQIM 214

  Fly   295 GDLIHSYVDRGQMYLTLHSYGSLILYPWGWTAAVPDTEEDLHEVAAAGQSAIQEATGTIY----- 354
            ..|..|:  ...:::.:||....:..|:......|:      .:.:.....:.|.....:     
plant   215 RKLAISF--DPHIWINVHSGMEALFMPYDHKNITPE------GLPSQKMRTLLEKLNKFHCHDRC 271

  Fly   355 KIGPSATTINYAASGASDDYAFN-AGFPISFTMEL 388
            .||....::.|.|.|.:.||.:: ...|::||.|:
plant   272 MIGSGGGSVGYLAHGTATDYIYDVVKAPMAFTFEI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416
M14_CP_A-B_like 127..420 CDD:199844 65/285 (23%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 53/229 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.