DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001364026.1 Gene:Agtpbp1 / 67269 MGIID:2159437 Length:1218 Species:Mus musculus


Alignment Length:280 Identity:52/280 - (18%)
Similarity:86/280 - (30%) Gaps:96/280 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TNKYEGYKIYEVSSEARSVAFSEALSELVKNAS---------YYEVFSELNA------------- 64
            :|.|..:..:|||.....||:...:....|:.|         .|.|...|||             
Mouse   734 SNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICY 798

  Fly    65 -------------GNPGKIMVHPHEQVNFVQLMEENNVKYDIINRNVGLTLSRQFETNRMLRHWF 116
                         |..||........|||..       |.|:.                    :|
Mouse   799 YKNHFSRSSVAAGGQKGKSYYTITFTVNFPH-------KDDVC--------------------YF 836

  Fly   117 PYNGRLGTERY-YNHEEINQFIEDLAGEH-PRRVFLK--TVGRSYEGRWLKTITITNGDAR---- 173
            .|:       | |.:..:...::.|...| |::::.:  .:..:..|.....:|||.....    
Mouse   837 AYH-------YPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNICPLVTITAMPESNYYE 894

  Fly   174 -----RNKNVILVDGGFHARE----WISPAAATYLINQLVYNLEDNADLLLDFDWVILPVVNPDG 229
                 |.:..|.:....|..|    |:......||::    |......|...:.:.|:|::||||
Mouse   895 HICQFRTRPYIFLSARVHPGETNASWVMKGTLEYLMS----NSPTAQSLRESYIFKIVPMLNPDG 955

  Fly   230 -----YEYTQLSED-TRMWR 243
                 :..:...|| .|.|:
Mouse   956 VINGNHRCSLSGEDLNRQWQ 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416 8/33 (24%)
M14_CP_A-B_like 127..420 CDD:199844 28/140 (20%)
Agtpbp1NP_001364026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..617
Pepdidase_M14_N 704..838 CDD:407865 23/130 (18%)
M14_Nna1 861..1131 CDD:349477 23/119 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1193..1218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.