DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and CG4408

DIOPT Version :9

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster


Alignment Length:414 Identity:138/414 - (33%)
Similarity:206/414 - (49%) Gaps:51/414 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KYEGYKIYEVS-SEARSVAFSEALSELVKNASYYEVFSELNAGNPGK---IMVHPHEQVNFVQLM 84
            :|:..:||:|. :....|...:||.:...:.|:..     :|..||:   |||...:..:|..|:
  Fly    80 RYDHTRIYQVELASEEHVRLFQALEQASDSCSFMG-----HARQPGQKLTIMVTGAKVADFDDLV 139

  Fly    85 EENNVKYDIINRNVGLTLSRQF------ETNRMLRHWFPYNGRLGTERYYNHEEINQFIEDLAGE 143
            ...||.:.::|.|....:...:      :|......|         :||:..|.||.:::.||..
  Fly   140 HSYNVTHRVLNYNFQALIDANYLEVAPEDTKPEEFDW---------KRYHPLESINAWLKKLAET 195

  Fly   144 HPRRVFLKTVGRSYEGRWLKTITITNGDARRNKNVILVDGGFHAREWISPAAATYLINQLVYNLE 208
            || .|.|..:|.|.:||.:..:.|...:  .|:..:.|:.|.||||||:||.|||:|:||| |.:
  Fly   196 HP-EVLLVELGVSAQGRPILGVQIAFDN--ENRTTVFVESGIHAREWIAPATATYIIDQLV-NSK 256

  Fly   209 DNA--DLLLDFDWVILPVVNPDGYEYTQLSEDTRMWRKTRKPSSSDCIGTDPNRNFDFHWNEEGA 271
            |:|  .|.....|.|.|.||||||:||  .:..|||||.| .....|.|.|.||||.||||..||
  Fly   257 DSAVQALARSQRWYIFPTVNPDGYQYT--FKGDRMWRKNR-ALFGICRGVDLNRNFPFHWNVTGA 318

  Fly   272 SDDPCDNIYAGAKPFSEPEALVVGDLIHSYV--DRGQMYLTLHSYGSLILYPWGWTAAVPDTEED 334
            |.|||...|:|....||.|...:.:.|...|  :|.:.:::||||..:|::|:|.:|...|...|
  Fly   319 SGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHD 383

  Fly   335 LHEVAAAGQSAIQEATGTIYKIGPSATTINYAASGASDDYAF-NAGFPISFTMELP--------- 389
            |.::.....:.|::.:|.|||.|....|| |.:||.|.|:|. ....||:|:.||.         
  Fly   384 LTDIGKLAANKIKDVSGRIYKSGSIYETI-YPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLF 447

  Fly   390 -FGGTGFDPPASD----IDSIVKE 408
             ......:|.|::    |.:||:|
  Fly   448 ILSAKEIEPTAAEAFASIQTIVQE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416 11/36 (31%)
M14_CP_A-B_like 127..420 CDD:199844 115/301 (38%)
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 17/75 (23%)
M14_CP_A-B_like 179..472 CDD:199844 115/301 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466973
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 1 0.900 - - OOG6_100142
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.