DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and CG8564

DIOPT Version :9

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:352 Identity:107/352 - (30%)
Similarity:165/352 - (46%) Gaps:41/352 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SRQFETNRMLRHWFPYNGRLGTERYYNHEEINQFIEDLAGEHPRRVFLKTVGRSYEGRWLKTITI 167
            ||...|..:.|...|....|.|  |.:::::||:::.||..:...|.:..:|.::|.|.::.:.|
  Fly    32 SRTDATTALRRLVIPRPDILHT--YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEI 94

  Fly   168 T-------------------------NGD--------ARRNKNVILVDGGFHAREWISPAAATYL 199
            .                         ||.        ....:..:.::.|.|||||||.:.|...
  Fly    95 NWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNC 159

  Fly   200 INQLVYNLEDNADLLLDFDWVILPVVNPDGYEYTQLSEDTRMWRKTRKP-SSSDCIGTDPNRNFD 263
            |.||......|.::|....::|:|:||||||||::....  .|||.|:| .|:..:|||.|||:|
  Fly   160 IYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNP--KWRKNRRPHKSAKFVGTDCNRNYD 222

  Fly   264 FHWNEEGASDDPCDNIYAGAKPFSEPEALVVGDLIHSYVDRGQMYLTLHSYGSLILYPWGWTAAV 328
            ..||...:..:  .|.|.|..||||||...:..::.........:|:|||||..|:||||:....
  Fly   223 IFWNSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDN 285

  Fly   329 PDTEEDLHEVAAAGQSAIQEATGTIYKIGPSATTINYAASGASDDYAFNA-GFPISFTMELPFGG 392
            |....:|..:|.:|:|||:...|..|:.|..:.......:|:..||.:.. ..|::..||||...
  Fly   286 PIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRE 350

  Fly   393 TGFDPPASDIDSIVKETWVGIAAMARK 419
            .||.||...|..|..|:|.||..|.::
  Fly   351 LGFQPPVEMISQIGHESWYGIREMCKR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416
M14_CP_A-B_like 127..420 CDD:199844 100/328 (30%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 100/326 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.