DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and oxy-5

DIOPT Version :10

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001293404.1 Gene:oxy-5 / 24104659 WormBaseID:WBGene00045483 Length:162 Species:Caenorhabditis elegans


Alignment Length:45 Identity:12/45 - (26%)
Similarity:19/45 - (42%) Gaps:8/45 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 TRKPSSSDCIGTDPNRNFDFHWNE-------EGASDDPCDNIYAG 282
            |...||...:|..| |.....||:       :|.|::.|:.:..|
 Worm   114 TPTASSIGPVGKIP-RGQGIEWNQLPQRFQRQGMSEEECEAVNTG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <70..105 CDD:460505
Peptidase_M14 133..412 CDD:459730 12/45 (27%)
oxy-5NP_001293404.1 S36_mt 75..157 CDD:402493 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.