DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18417 and CPO

DIOPT Version :9

Sequence 1:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:337 Identity:117/337 - (34%)
Similarity:182/337 - (54%) Gaps:25/337 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LTLSRQFETNRMLRHW----FPYNGRLGTERYYNHEEINQFIEDLAGEHPRRVFLKTVGRSYEGR 160
            |...||...::.:..|    :.||      .|:...||.:::.:::.::...|....:|.:||..
Human    25 LAQHRQEIVDKSVSPWSLETYSYN------IYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETH 83

  Fly   161 ---WLKTITITNGDARRNKNVILVDGGFHAREWISPAAATYLINQLVYNLEDNAD---LLLDFDW 219
               :|| |:..:|:.   |.:|.:|.|.||||||:||...:.:.:::.|.:||:.   ||.:.|:
Human    84 PMYYLK-ISQPSGNP---KKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDF 144

  Fly   220 VILPVVNPDGYEYTQLSEDTRMWRKTRKP-SSSDCIGTDPNRNFDFHWNEEGASDDPCDNIYAGA 283
            .:|||:|.|||.||..::  |:|||:|.| ::..|.|||.||||:..|...|||.:..|..:.|.
Human   145 YVLPVLNIDGYIYTWTTD--RLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGT 207

  Fly   284 KPFSEPEALVVGDLIHSYVDRGQMYLTLHSYGSLILYPWGWTAAVPDTEEDLHEVAAAGQSAIQE 348
            .|.||||...|...|.|..|....:||:||||.|||.|:|:|........::.:|.....:|::.
Human   208 GPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKA 272

  Fly   349 ATGTIYKIGPSATTINYAASGASDDYAFNAGFPISFTMELPFGGT-GFDPPASDIDSIVKETWVG 412
            ..||.|::|.|| .|.||:||:|.|:|.:.|.|.|:|.||...|| ||..|.:.|....:||...
Human   273 KYGTNYRVGSSA-DILYASSGSSRDWARDIGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEA 336

  Fly   413 IAAMARKVIQKY 424
            :.::...|..|:
Human   337 VLSVLDDVYAKH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416
M14_CP_A-B_like 127..420 CDD:199844 109/300 (36%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 111/309 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.