DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and AGBL4

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:350 Identity:77/350 - (22%)
Similarity:124/350 - (35%) Gaps:100/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDG---KANKKVIFMDGGFHARE 186
            ||:....:|:|.|.:|.....|.:.:|.|.:||.|..:|||:.|.   .|.:||:|:.|..|..|
Human   181 YTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGE 245

  Fly   187 -----------------------------WISPAAVLYVIDQLVEQFEENAHLLKDY-DWVILPL 221
                                         |:||.    :||.||.| ...|.:|::| .:.|.|:
Human   246 TPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPG----IIDFLVSQ-HPIACVLREYLVFKIAPM 305

  Fly   222 VNADG-----YEHTQTG-TLARMWRKTRQPYTYAGQTCYGA---------DPNRNFDFHWNEEGA 271
            :|.||     |..:..| .|.|.|   ..|..:...|.:|.         ||..:.:|:      
Human   306 LNPDGVYLGNYRCSLMGFDLNRHW---LDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFY------ 361

  Fly   272 SSNPCADTYAGPTAFSEPETITVRDLMHSLADRGIMYLTL----HSYGNYLLYPWGWTSDLPENW 332
                 .|.:|                 ||....|.||..:    ..:....::|    ..|.:|.
Human   362 -----IDIHA-----------------HSTMMNGFMYGNIFEDEERFQRQAIFP----KLLCQNA 400

  Fly   333 EDLDAVART-GAEAIENATGTVYTYGSSTNVLYIAAGASDDYGY-YAGFNVSITMELPGAGSIGF 395
            ||....:.: ..:|::..||..:..|...:..|........|.| .:|...::.........:|.
Human   401 EDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEAYMKLGR 465

  Fly   396 NPPVTRIDEFVTETWIGIRAMAEKV 420
            |...|.:|      :..:..:.|||
Human   466 NVARTFLD------YYRLNPVVEKV 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 75/348 (22%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 71/330 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.