DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and Agbl4

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011238954.1 Gene:Agbl4 / 78933 MGIID:1918244 Length:552 Species:Mus musculus


Alignment Length:330 Identity:77/330 - (23%)
Similarity:123/330 - (37%) Gaps:85/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDG---KANKKVIFMDGGFHARE 186
            ||:....:|:|.|.::.....|.:.:|.|.:||.|..:|||:.:.   .:.|||||:.|..|..|
Mouse   181 YTYTRFQHYLDSLQKKNMDYFFREQLGQSVQQRQLDLLTITSPENLREGSEKKVIFITGRVHPGE 245

  Fly   187 WISPAAVLYVIDQLVEQFEENAHLLKDY-DWVILPLVNADG-----YEHTQTG-TLARMWRKTRQ 244
            ..|......:||.||.| ...|.:|::: .:.|.|::|.||     |..:..| .|.|.|   ..
Mouse   246 TPSSFVCQGIIDFLVSQ-HPIARVLREHLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHW---LD 306

  Fly   245 PYTYAGQTCYGA---------DPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHS 300
            |..:|..|.:|.         ||..:.:|:           .|.:|                 ||
Mouse   307 PSPWAHPTLHGVKQLIIKMYNDPKTSLEFY-----------IDIHA-----------------HS 343

  Fly   301 LADRGIMYLTLHSYGNYL----------LYPWGWTSDLPENWEDLDAVART-GAEAIENATGTVY 354
            ....|.|      |||..          ::|    ..|.:|.||....:.: ..:|::..||..:
Mouse   344 TMMNGFM------YGNIFEDEERFQRQSIFP----KLLCQNAEDFSYTSTSFNRDAVKAGTGRRF 398

  Fly   355 TYGSSTNVLYIAAGASDDYGYYAGFNVSITMELP----GAGSIGFNPPVTRIDEFVTETWIGIRA 415
            ..|...:..|........|.|..|   ..|..:|    ....:|.|...|.:|      :..:.:
Mouse   399 LGGLLDHSSYCYTLEVSFYSYIIG---GTTAAVPYTEEAYMKLGRNVARTFLD------YYRLNS 454

  Fly   416 MAEKV 420
            :.||:
Mouse   455 LVEKI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 76/328 (23%)
Agbl4XP_011238954.1 Pepdidase_M14_N 65..>142 CDD:375499
M14_AGBL4_like 199..450 CDD:349479 70/301 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.