DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and Agbl3

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:218 Identity:45/218 - (20%)
Similarity:81/218 - (37%) Gaps:70/218 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYI-----DDLAQRF-PSRVFVKTVGWSYEQRVLKTITIT----NGDGKANKKVIFMD 179
            ||:..:..|:     |.:..:| ..||...|:.    :.::..:|||    ..|.|  :|.:.:.
Mouse   306 YTYSNLQEYLSGINSDPVRSKFCKIRVLCHTLA----RNMVYVLTITTPLKTSDSK--RKAVILT 364

  Fly   180 GGFHARE----WISPAAVLYVIDQLVEQFEENAHLLKD-YDWVILPLVNADGYEHTQTGTLARMW 239
            ...|..|    ||....:.|::..     ..:|.||:| :.:.::|::|.|       |.:...:
Mouse   365 ARVHPGETNSSWIMKGFLDYILGD-----SSDARLLRDTFIFKVVPMLNPD-------GVIVGNY 417

  Fly   240 RKTRQPYTYAGQTC--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLA 302
            |            |  .|.|.|||:.....|                  |.|.....|::::.|.
Mouse   418 R------------CSLAGRDLNRNYTSLLKE------------------SFPSVWYTRNMINRLM 452

  Fly   303 DRG--IMYLTLHSYG---NYLLY 320
            ::.  |:|..||.:.   |..:|
Mouse   453 EKREVILYCDLHGHSRKQNIFMY 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 45/218 (21%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 42/209 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.