DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and Cpo

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:345 Identity:85/345 - (24%)
Similarity:144/345 - (41%) Gaps:86/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QRLLAPITGKGRLSTERYYT-HEEIINYIDDLAQRFP---SRVFVKTVGWSYEQRVLK---TITI 164
            |..::|.......|.:||:. ...|..::..:::::.   ::.|::....::....||   .|::
  Rat     8 QEFVSPQRSLETYSYDRYHPWGRGIYQWMRQVSEKYAEVLTQHFLRMTYETWPMHYLKESAEISL 72

  Fly   165 TNGDGKANKKVIFMDGGFHAREWISPA--------------------AVLYVID----------- 198
            |:.:   :||.|::|.|.||..||:||                    |:.|:..           
  Rat    73 TSSN---SKKTIWIDCGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFPV 134

  Fly   199 ----------QLVEQFEENA---HLLKDYDWVILPLVNADG--YEHTQTGTLARMWRKTRQPYTY 248
                      |:::..:::|   .|||:.|:.:|   ||||  |..|...||.          ..
  Rat   135 NWNGIQLAPLQILQNDKDSARIGRLLKELDFXVL---NADGXIYTWTTAWTLP----------VG 186

  Fly   249 AGQTCYGADPNRNFDFHWNEEGASSNPCAD-TYAGPTAFSEPETITVRDLMHSLADRGIM-YLTL 311
            .|..|.             ..|...| |.| |:.|.....|||....:.|..:...:.|: :|.:
  Rat   187 QGYLCL-------------HIGTPIN-CQDVTFCGIEPMLEPELTPSQALQKARGKKDILCFLIM 237

  Fly   312 HSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASDDYGYY 376
            .|||..:|.|:|.|.:.|.|:|:|..|.:..|.|::...||.|..||..::||:.:|:|.|:...
  Rat   238 GSYGQLILTPYGHTKNKPHNYEELIQVGQKAARALKAKHGTNYRVGSGADILYMLSGSSKDWNGG 302

  Fly   377 AGFNV-SITMELPGAGSIGF 395
            .|..: |.|.||...|:.||
  Rat   303 IGIPLFSYTFELVDNGTHGF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 81/328 (25%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 82/331 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.