DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and agbl2

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:218 Identity:41/218 - (18%)
Similarity:80/218 - (36%) Gaps:68/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDL------AQRFPSRVFVKTVGWSYEQRVLKTITITN-----GDGKANKKVIFM 178
            ||:.::.:|:.::      |.....||..:::..:    .:..:|||.     .:.|| |:.:.:
Zfish   336 YTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGN----AVYVLTITAPSSSLAERKA-KRAVVV 395

  Fly   179 DGGFHARE----WISPAAVLYVIDQLVEQFEENAHLLKD-YDWVILPLVNADGYEHTQTGTLARM 238
            ....|..|    |:....:.:::..|     .:||||:: :.:.::|::|.||            
Zfish   396 TARVHPGETNGSWMMQGFLEFLLSDL-----PDAHLLRETFIFKVIPMLNPDG------------ 443

  Fly   239 WRKTRQPYTYAGQTC--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSL 301
                   .......|  .|.|.|||:.....:    |.||.             ..|...:...|
Zfish   444 -------VVVGNYRCSLAGRDLNRNYRSMLRD----SFPCI-------------WYTRNMVKRLL 484

  Fly   302 ADRG-IMYLTLHSY---GNYLLY 320
            |:|. ::|...|.:   .|..:|
Zfish   485 AEREVVVYCDFHGHSRKNNVFMY 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 41/218 (19%)
agbl2XP_017209580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.