DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and CG8564

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:335 Identity:111/335 - (33%)
Similarity:175/335 - (52%) Gaps:42/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YYTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITIT----------------------- 165
            |..::::..|:..||||:...|.|..:|.::|:|.::.:.|.                       
  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118

  Fly   166 --NGD--------GKANKKVIFMDGGFHAREWISPAAVLYVIDQLVEQFEENAHLLKDYDWVILP 220
              ||.        |:..:|.:|::.|.|||||||.:..|..|.||.|::..|..:|:...::|:|
  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLRFIIVP 183

  Fly   221 LVNADGYEHTQTGTLARMWRKTRQPYTYAGQTCYGADPNRNFDFHWNEEGASSNPCADTYAGPTA 285
            |||.||||:::|..  ..|||.|:|:..|  ...|.|.|||:|..||...:..|  .:||.|.:.
  Fly   184 LVNPDGYEYSRTKN--PKWRKNRRPHKSA--KFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESP 242

  Fly   286 FSEPETITVRDLMHSLADRGIMYLTLHSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENAT 350
            ||||||..:|.::..::...:.:|:|||||..::||||:..|.|..|.:|.::|.:|..||::..
  Fly   243 FSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYN 307

  Fly   351 GTVYTYGS-STNVLYIAAGASDDYGY-YAGFNVSITMELPGAGSIGFNPPVTRIDEFVTETWIGI 413
            |..|..|| |.......||:..||.| .....:::.|||| :..:||.|||..|.:...|:|.||
  Fly   308 GREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELP-SRELGFQPPVEMISQIGHESWYGI 371

  Fly   414 RAMAEKVIEM 423
            |.|.::..::
  Fly   372 REMCKRSFDL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 111/330 (34%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 111/329 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.