DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and Agbl2

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038962721.1 Gene:Agbl2 / 366124 RGDID:1306827 Length:861 Species:Rattus norvegicus


Alignment Length:225 Identity:47/225 - (20%)
Similarity:80/225 - (35%) Gaps:60/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDLAQRFPSRVFVK--TVGWSYEQRVLKTITITN----GDGKANKKVIFMDGGFH 183
            ||:.::..|:..:|.......|.|  .:..|.....:..:||||    ....|.||.:.:....|
  Rat   361 YTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVH 425

  Fly   184 ARE----WISPAAVLYVIDQLVEQFEENAHLLKD-YDWVILPLVNADGYEHTQTGTLARMWRKTR 243
            ..|    ||....:.:::..     ..:|.||:| :.:.::|::|.|       |.:...:|   
  Rat   426 PGESNSSWIMNGFLDFILSD-----SPDAQLLRDIFVFKVIPMLNPD-------GVIVGNYR--- 475

  Fly   244 QPYTYAGQTC--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGI 306
                     |  .|.|.||    |:......|.||.             ..|...:...|.:|.:
  Rat   476 ---------CSLAGRDLNR----HYKTVLKDSFPCI-------------WYTKNMIKRLLEEREV 514

  Fly   307 -MYLTLHSY---GNYLLYPWGWTSDLPENW 332
             :|...|.:   .|..||  |..|:..::|
  Rat   515 LLYCDFHGHSRKNNIFLY--GCHSNNRKHW 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 47/225 (21%)
Agbl2XP_038962721.1 Pepdidase_M14_N 231..358 CDD:407865
M14_AGBL2-3_like 379..629 CDD:349478 43/207 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.