DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and Nna1

DIOPT Version :10

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001285225.1 Gene:Nna1 / 32329 FlyBaseID:FBgn0265726 Length:1890 Species:Drosophila melanogaster


Alignment Length:210 Identity:40/210 - (19%)
Similarity:79/210 - (37%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDLAQRFP-------SRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGF 182
            ||:.::.:|:.:: ||.|       .|:..:|:..:....:..|...:|.:....||.|.:....
  Fly   762 YTYSDLQDYLMEI-QRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARV 825

  Fly   183 HAREWISPAAVLY--VIDQLVEQFEENAHLLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQP 245
            |..|  :||:.:.  ::|.:.........|...:.:.::|::|.||.          :...||..
  Fly   826 HPSE--TPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGV----------IVGNTRNS 878

  Fly   246 YTYAGQTCYGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADR-GI-MY 308
            .|       |.|.||.:          .....:||        |.....:.::..|.:. |: ||
  Fly   879 LT-------GKDLNRQY----------RTVIRETY--------PSIWYTKAMIRRLIEECGVAMY 918

  Fly   309 LTLHSYG---NYLLY 320
            ..:|::.   |..:|
  Fly   919 CDMHAHSRKHNIFIY 933

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 29..100 CDD:460505
Peptidase_M14 130..412 CDD:459730 38/205 (19%)
Nna1NP_001285225.1 Pepdidase_M14_N 623..758 CDD:407865
M14_AGBL2-3_like 780..1031 CDD:349478 34/191 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.