DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and CG31019

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:344 Identity:74/344 - (21%)
Similarity:124/344 - (36%) Gaps:130/344 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYID--DLAQ----RFPSRVFVKTVGWSYEQRVLKTITI---------TNGDGKANKK 174
            |::..:.:|::  |..|    ||...|.||    |.:.|.:..:||         ||...::..:
  Fly   178 YSYSRLQSYLNVIDARQGSDKRFTRCVLVK----SLQNRNVDLLTIDHVTAKQRSTNRLDRSFIR 238

  Fly   175 VIFMDGGFHAREWISPAAVLYVIDQLVEQFEEN---AHLLKD-YDWVILPLVNADGYEHTQTGTL 235
            ||.:....|:.|  :||:  :|...|:|....|   |.:|:| :.:.|:|:||.||         
  Fly   239 VIVVLCRTHSSE--APAS--HVCQGLIEFLVGNHPIAAVLRDNFVFKIVPMVNPDG--------- 290

  Fly   236 ARMWRKTRQPYTYAGQT-C--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDL 297
                       .:.|.. |  .|.|.|||  :|...|                |::||...|:.:
  Fly   291 -----------VFLGNNRCNLMGQDMNRN--WHIGSE----------------FTQPELHAVKGM 326

  Fly   298 MHSL----ADRGI-----------------------MYLTLHS---------YGN---------- 316
            :..|    ..|||                       ..:.||:         |||          
  Fly   327 LKELDNSDVSRGIETDLIGIIFVCSYNISFQTYQIDFVIDLHANSSMHGCFIYGNTYEDVYRYER 391

  Fly   317 YLLYPWGWTSDLPENWED----------LDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGAS- 370
            :|::|..:.|:..:...|          ..::.|...|.:.: |...||...|....|:..|.: 
  Fly   392 HLVFPRLFASNAQDYVADHTMFNADERKAGSMRRFSCERLSD-TVNAYTLEVSMAGHYLKDGKTI 455

  Fly   371 ---DDYGYY-AGFNVSITM 385
               ::.||| .|.|::.|:
  Fly   456 SLYNEDGYYRVGRNLARTL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 74/344 (22%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 72/332 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.