DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:291 Identity:52/291 - (17%)
Similarity:89/291 - (30%) Gaps:104/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NKKVIFMDGGFHARE----WISPAAVLYVIDQLVEQFEENAHLLKD-YDWVILPLVNADGYEHTQ 231
            |:..:|:....|..|    |:....:.|::..     ...|..|:: |.:.|:|::|.||..:  
Human   961 NRPYVFLSARVHPGETNASWVMKGTLEYLMSN-----NPTAQSLRESYIFKIVPMLNPDGVIN-- 1018

  Fly   232 TGTLARMWRKTRQPYTYAGQTC--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITV 294
                             ....|  .|.|.||    .|      .:|..|.:  ||.:.      .
Human  1019 -----------------GNHRCSLSGEDLNR----QW------QSPSPDLH--PTIYH------A 1048

  Fly   295 RDLMHSLA---DRGIMYLTLHSYG---NYLLYPWG-----WTSDLPENWEDLDAVARTG------ 342
            :.|:..||   ...::|...|.:.   |..:|...     |.::  :|....|.|..||      
Human  1049 KGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTN--DNATSCDVVEDTGYRTLPK 1111

  Fly   343 -----------------AEAIENATGTVYTY---GSSTNVLYIAAGASDDYGYYAGFNVSITMEL 387
                             .|..:.:|..|..:   |...:....:.....|.|.|.|..:. |.||
Human  1112 ILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIG-TREL 1175

  Fly   388 PGAGS---------------IGFNPPVTRID 403
            ...|:               :.:|.|.:.:|
Human  1176 EEMGAKFCVGLLRLKRLTSPLEYNLPSSLLD 1206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 52/291 (18%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 49/271 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.