DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and AGBL1

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:335 Identity:57/335 - (17%)
Similarity:107/335 - (31%) Gaps:121/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YTHEEIINYIDDLAQR-------FPSRVFVKTVGWS---------------------YEQRVLKT 161
            ||:..::.::|.|.:.       |...|..:|:|.:                     :..|..:.
Human   734 YTYTALMTHLDILEKSVNLKEVYFRQDVLCQTLGGNPCPLVTITAMPESNSDEHLEQFRHRPYQV 798

  Fly   162 ITITNGDGKANKKVIFMDGGFHAREWISPAAVLYVIDQLVEQFEENAHLLKD-YDWVILPLVNAD 225
            ||.....|::|            ..|:....:.:::..     :..|.||:: :.:.|:|::|.|
Human   799 ITARVHPGESN------------ASWVMKGTLEFLVSS-----DPVARLLRENFIFKIIPMLNPD 846

  Fly   226 GYEHTQTGTLARMWRKTRQPYTYAGQTC--YGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSE 288
            |..:                   ....|  .|.|.||.                  :..|:|..:
Human   847 GVIN-------------------GNHRCSLSGEDLNRQ------------------WLSPSAHLQ 874

  Fly   289 PETITVRDLMHSLADRG---IMYLTLHSYG---NYLLYP-------W------GWTSDLPE-NWE 333
            |.....:.|::.|:..|   :::...|.:.   |..||.       |      |.::.|.| |:.
Human   875 PTIYHAKGLLYHLSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYR 939

  Fly   334 DLDAVARTGAEAIENATGTVYTYGSSTN----VLYIAAGASDDY-----------GYYAGFNVSI 383
            .|..:....|.|...::.:.....|..:    |::...|.|..|           |.|.|.... 
Human   940 TLPKILDKLAPAFTMSSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQGLQFG- 1003

  Fly   384 TMELPGAGSI 393
            |.||...|::
Human  1004 TRELEEMGAM 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 57/335 (17%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865
M14_Nna1 754..1019 CDD:349477 53/315 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.